PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07690.1
Common NameATMYB29, HAG3, MBK20.15, MYB29, PMG2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 336aa    MW: 37966 Da    PI: 4.969
Description myb domain protein 29
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07690.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
      AT5G07690.1 14 KGAWTAEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.67.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
      AT5G07690.1  67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.277965IPR017930Myb domain
SuperFamilySSF466894.31E-2911108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-171461IPR001005SANT/Myb domain
CDDcd001676.20E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2465114IPR009057Homeodomain-like
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.79766116IPR017930Myb domain
PfamPF002491.9E-1367112IPR001005SANT/Myb domain
CDDcd001671.19E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010438Biological Processcellular response to sulfur starvation
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006325anatomyinflorescence node
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTAE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEIKNYWNT HLKKLLIDKG  120
IDPVTHKPLA YDSNPDEQSQ SGSISPKSLP PSSSKNVPEI TSSDETPKYD ASLSSKKRCF  180
KRSSSTSKLL NKVAARASSM GTILGASIEG TLISSTPLSS CLNDDFSETS QFQMEEFDPF  240
YQSSEHIIDH MKEDISINNS EYDFSQFLEQ FSNNEGEEAD NTGGGYNQDL LMSDVSSTSV  300
DEDEMMQNIT GWSNYLLDHS DFNYDTSQDY DDKNFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241211425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO143349430.0
Genevisible250598_at0.0
Expression AtlasAT5G07690-
AtGenExpressAT5G07690-
ATTED-IIAT5G07690-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Primarily present around the midvein in seedlings. Accumulates gradually in expanding leaves, reaching a maximum in fully expanded leaves in the primary vein. {ECO:0000269|PubMed:18042203}.
UniprotTISSUE SPECIFICITY: Expressed in both vegetative and generative organs. Mostly present in seedlings, inflorescences, roots and stems, and, to a lower extent, in leaves (in midvein and trichomes) and siliques. {ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:23115560, ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB29).
UniProtPlays a minor rheostat role in aliphatic glucosinolates (GLSs) biosynthesis, mostly short chained. Together with MYB28/HAG1 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae) by promoting glucosinolates. {ECO:0000269|PubMed:17420480, ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:18446225, ECO:0000269|PubMed:20348214, ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23792303, ECO:0000269|PubMed:23943862}.
Function -- GeneRIF ? help Back to Top
  1. Myb29 presumably plays an accessory function for methyl jasmonate-mediated induction of a set of aliphatic glucosinolate biosynthetic genes.
    [PMID: 17420480]
  2. HAG1/MYB28, HAG2/MYB76 and HAG3/MYB29 reciprocally transactivated each other in the control of aliphatic glucosinolate biosynthesis and downregulated the expression of genes involved in the control of indolic glucosinolate biosynthesis.
    [PMID: 18042203]
  3. MYB76 is not dependent on MYB28 and MYB29 for induction of aliphatic glucosinolates.
    [PMID: 20348214]
  4. MYB28 and MYB29 synergistically functioned in the glucose-induced biosynthesis of aliphatic glucosinolates, but MYB28 was predominant over MYB29.
    [PMID: 23329848]
  5. MYB28 expression was induced by sulfur deficiency, while the expression levels of MYB29 and MYB76 were positively correlated with sulfur concentration.
    [PMID: 23792303]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07690.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by gibberellic acid (GA), jasmonic acid (JA, MeJA), nitrogen starvation and UV LIGHT treatment. Transiently repressed by salicylic acid (SA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:23792303, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G16400(A), AT1G16410(A), AT4G13770(A), AT5G23010(A), AT5G61420(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G46760, AT5G46830, AT1G32640
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Low levels of aliphatic glucosinolates. {ECO:0000269|PubMed:23580754}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0351450.0AY035145.1 Arabidopsis thaliana putative transcription factor (At5g07690) mRNA, complete cds.
GenBankAY0590780.0AY059078.1 Arabidopsis thaliana putative transcription factor (At5g07690) mRNA, complete cds.
GenBankAY5196170.0AY519617.1 Arabidopsis thaliana MYB transcription factor (At5g07690) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196386.10.0myb domain protein 29
SwissprotQ9FLR10.0MYB29_ARATH; Transcription factor MYB29
TrEMBLD7M0L60.0D7M0L6_ARALL; Putative uncharacterized protein
STRINGAT5G07690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Li J,Brader G,Palva ET
    The WRKY70 transcription factor: a node of convergence for jasmonate-mediated and salicylate-mediated signals in plant defense.
    Plant Cell, 2004. 16(2): p. 319-31
    [PMID:14742872]
  5. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  6. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Millenaar FF, et al.
    How to decide? Different methods of calculating gene expression from short oligonucleotide array data will give different results.
    BMC Bioinformatics, 2006. 7: p. 137
    [PMID:16539732]
  9. Knight CA, et al.
    Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient.
    Mol. Ecol., 2006. 15(5): p. 1229-37
    [PMID:16626450]
  10. Hirai MY, et al.
    Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6478-83
    [PMID:17420480]
  11. Swindell WR,Huebner M,Weber AP
    Plastic and adaptive gene expression patterns associated with temperature stress in Arabidopsis thaliana.
    Heredity (Edinb), 2007. 99(2): p. 143-50
    [PMID:17473866]
  12. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  13. Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
    HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana.
    New Phytol., 2008. 177(3): p. 627-42
    [PMID:18042203]
  14. S
    A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates.
    PLoS ONE, 2007. 2(12): p. e1322
    [PMID:18094747]
  15. Beekwilder J, et al.
    The impact of the absence of aliphatic glucosinolates on insect herbivory in Arabidopsis.
    PLoS ONE, 2008. 3(4): p. e2068
    [PMID:18446225]
  16. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  17. Malitsky S, et al.
    The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators.
    Plant Physiol., 2008. 148(4): p. 2021-49
    [PMID:18829985]
  18. S
    A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis.
    Plant Physiol., 2010. 153(1): p. 348-63
    [PMID:20348214]
  19. M
    Differential effects of indole and aliphatic glucosinolates on lepidopteran herbivores.
    J. Chem. Ecol., 2010. 36(8): p. 905-13
    [PMID:20617455]
  20. Stotz HU, et al.
    Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum.
    Plant J., 2011. 67(1): p. 81-93
    [PMID:21418358]
  21. van de Mortel JE, et al.
    Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101.
    Plant Physiol., 2012. 160(4): p. 2173-88
    [PMID:23073694]
  22. Frerigmann H,B
    Glucosinolates are produced in trichomes of Arabidopsis thaliana.
    Front Plant Sci, 2012. 3: p. 242
    [PMID:23115560]
  23. Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C
    Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.).
    PLoS ONE, 2012. 7(11): p. e48661
    [PMID:23144921]
  24. Miao H, et al.
    Glucose signalling positively regulates aliphatic glucosinolate biosynthesis.
    J. Exp. Bot., 2013. 64(4): p. 1097-109
    [PMID:23329848]
  25. Guo R, et al.
    BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis.
    J. Exp. Bot., 2013. 64(8): p. 2401-12
    [PMID:23580754]
  26. Li Y, et al.
    Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis.
    Plant Cell Physiol., 2013. 54(8): p. 1335-44
    [PMID:23792303]
  27. Schweizer F, et al.
    Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.
    Plant Cell, 2013. 25(8): p. 3117-32
    [PMID:23943862]
  28. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]
  29. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  30. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]